PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G18440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 1145aa    MW: 124948 Da    PI: 8.4922
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G18440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.37.7e-14104164161
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      +ke +r +r+ +NR++A+  R+RKka++ eLe kvk Le  N++L ++l++l++e + l++
  OPUNC06G18440.1 104 DKEHRRLKRLLRNRVSAQQARERKKAYMSELEVKVKDLERSNSELEERLSTLQNENQMLRQ 164
                      58899***************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-15104168IPR004827Basic-leucine zipper domain
PfamPF001709.4E-13105164IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.564106169IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-16108168No hitNo description
SuperFamilySSF579595.13E-12108166No hitNo description
PROSITE patternPS000360111126IPR004827Basic-leucine zipper domain
CDDcd147041.24E-17118160No hitNo description
SuperFamilySSF534482.39E-6314373IPR029044Nucleotide-diphospho-sugar transferases
PfamPF035523.1E-2453141042IPR005150Cellulose synthase
SuperFamilySSF534482.39E-6479615IPR029044Nucleotide-diphospho-sugar transferases
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030244Biological Processcellulose biosynthetic process
GO:0071555Biological Processcell wall organization
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016760Molecular Functioncellulose synthase (UDP-forming) activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1145 aa     Download sequence    Send to blast
MITNSIAMAV EIYSMLPRIL YIFFDLAISL AGMDSDDEEI GRVPEFGLAL PGTSSSPAST  60
SGRGNIRAAG DAAVTAAGTS SSPAAQASVA SSSSGRRRGR SPADKEHRRL KRLLRNRVSA  120
QQARERKKAY MSELEVKVKD LERSNSELEE RLSTLQNENQ MLRQVLKNTT ANRRGPDSSA  180
GGDSYSEMDG ESPEIMPVEC PDPETASSES GDEHGIPEPL SSRLPIPSGE LNLYRAAVAL  240
RLVLLAAFFH YRVTHPVADA HALWATSVAC ELWLAASWLI GQVPKLSPAN RVTYLDRLAS  300
RYEKDGEASR LAGVDVFVTA AREAPLATAN TVLSVLAADY PAGGVACYVH DDGADMLVFE  360
SLFEAAGFAR RWIPFCRRHG VEPRAPEFYF ARGVDYLRDR AAPSFVKDRR AMKREYEEFK  420
VRMNYLAAKA RKVPEEGWIM SDGTPWPGNN PRDHPAMIQV LLGHPGDRDV DGGELPRLFY  480
VSREKRPGFR HHGKAGAMNA LLRVSAVLTN GAYVLNLDCD HCVNNSSTLR EAMCFLMDPV  540
AGNRTCFVQF ALRDGDGDGD DDGGDSVFFD IEMRCLDGIQ GPVYVGSGCC FSRKALYGFE  600
PAAAEDGDDM ETSANWRRMC CFGREKRTSA MRRSMSALPL LDSEDDSDEQ EEAAGRRRLR  660
AYRAALQRHF GQSPAFIASA FREQGRRGGD GGLLDATVAR SRSLLKEAIH VVSCAFEERT  720
RWGKEIGWVY GGIGGDGAGV ATGFKMHVRG WSSAYCSPAL PAFRSYSRAS PTDVLAGASR  780
RAVAAMGILL SRRHSPVWAG WGGGRLGLLQ RLGYVSRIPY PLASLPLTVY CALPAVCLLT  840
GKSTFPGDVS YYDGVLLILL LFSVAASVVL ELRWSRVPLR AWWRDEKLWV VTATSAGLAA  900
VFQGILSACT GIDVAFSFST ETAASPTKRP PGKEEEPLAS ETPTRTVRWT NLLVPPTSVV  960
VANLAGVVVA VAYGVDHGYY QSWGALGAKL ALAGWVVAHL QGFLRGLLAQ RDRAPPTIVL  1020
LWSVVFVSVV LLLWVHAASF LTPTAPHPSL ACYLPPFGLP NFGPAHKWSH TTSSHVFNLW  1080
KTVSCSYDIG ADPPHQIQPN LSRSPKMGRG LLIHSIFPFR FSQNWTSPQN MRKNGRTSSS  1140
VGHHR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641259.10.0PREDICTED: putative cellulose synthase A catalytic subunit 11
SwissprotQ69XK50.0CESAB_ORYSJ; Putative cellulose synthase A catalytic subunit 11 [UDP-forming]
TrEMBLA0A0E0LD900.0A0A0E0LD90_ORYPU; Uncharacterized protein
STRINGLOC_Os06g39970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1427255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.12e-23bZIP family protein